DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and Rab43

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001034483.1 Gene:Rab43 / 69834 MGIID:1917084 Length:210 Species:Mus musculus


Alignment Length:198 Identity:91/198 - (45%)
Similarity:130/198 - (65%) Gaps:1/198 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQER 72
            ||:||||:|:||:.|||:|::.||....::....|||||||.::|:|:.||.:||||||||||||
Mouse    13 YDFLFKLVLVGDASVGKTCVVQRFKTGAFSARQGSTIGVDFTMKTLEIQGKRVKLQIWDTAGQER 77

  Fly    73 FRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVVDHT 137
            |||||.||||.|:|.|:.||.:.:.:|.:|..|:|::.:||..|:.:||:||||||...:.|...
Mouse    78 FRTITQSYYRSANGAILAYDISKRSTFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLADFREVPLA 142

  Fly   138 TAAEYAAQLGI-PFLETSAKSATNVEQAFMTMAAEIKNRVGPPSSATDNASKVKIDQGRPVENTK 201
            .|...|....| ..:|||||.::|||:||..:|.|:..|.|.|..:..|...:::|.....|:..
Mouse   143 EAQSLAEHYDILCAIETSAKDSSNVEEAFTRVATELIMRHGGPMFSEKNTDHIQLDSKDIAESWG 207

  Fly   202 SGC 204
            .||
Mouse   208 CGC 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 81/165 (49%)
Rab43NP_001034483.1 Rab19 14..178 CDD:133267 81/163 (50%)
Effector region. /evidence=ECO:0000250 45..53 5/7 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.