DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and LOC555645

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_009295987.1 Gene:LOC555645 / 555645 -ID:- Length:280 Species:Danio rerio


Alignment Length:205 Identity:85/205 - (41%)
Similarity:129/205 - (62%) Gaps:11/205 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERF 73
            |:|||::|||||.|||:|::..|.....||...:||||||.:|::::||:.:|:|:|||||||||
Zfish    76 DFLFKIILIGDSNVGKTCVIQSFRSAEVTELQHNTIGVDFTVRSMDVDGRRVKMQVWDTAGQERF 140

  Fly    74 RTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVV---D 135
            ||||.||||.|||.::.||.:.:::|:::..|::.:|:|...::..:|:|||.||..::.|   |
Zfish   141 RTITQSYYRSAHGAMIAYDLSRRDTFDSLPHWIQALEQYGAASLVLVLIGNKCDLEAQRQVLFED 205

  Fly   136 HTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVGP---PSSATDNASKVKIDQGRPV 197
            ..|.||.:..|..  ||||||...|:|:||..||.|:..|.|.   ..:.:|:.:........|:
Zfish   206 ACTLAERSGALAA--LETSAKHHHNIEEAFQLMARELLVRHGGIHYQDNQSDSPTVYLHSDSHPI 268

  Fly   198 EN---TKSGC 204
            |.   .|..|
Zfish   269 EGEQLEKRSC 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 77/167 (46%)
LOC555645XP_009295987.1 P-loop_NTPase 76..240 CDD:304359 77/165 (47%)
RAB 79..241 CDD:197555 76/163 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.