DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and rab3ab

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001017761.1 Gene:rab3ab / 550457 ZFINID:ZDB-GENE-041210-268 Length:220 Species:Danio rerio


Alignment Length:184 Identity:85/184 - (46%)
Similarity:125/184 - (67%) Gaps:0/184 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SVNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDT 67
            |.:..:||:||:|:||:|.|||:..|.|:|||::|.:::||:|:|||::||..:.|.||||||||
Zfish    14 SSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDT 78

  Fly    68 AGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKK 132
            |||||:||||::|||||.|.|::||.|::|||..|:.|..:|:.|:.:|...||||||.|:..::
Zfish    79 AGQERYRTITTAYYRGAMGFILMYDITNEESFAAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDER 143

  Fly   133 VVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVGPPSSATDNA 186
            ||......:.:..||..:.|.|||...||:|.|..:...|..::.....|.|.|
Zfish   144 VVASERGRQLSEHLGFEYFEASAKDNINVKQTFERLVDIICEKMSESLDAADPA 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 80/164 (49%)
rab3abNP_001017761.1 Rab3 22..186 CDD:206657 79/163 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.