DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and Rab19

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001019497.1 Gene:Rab19 / 500088 RGDID:1565263 Length:217 Species:Rattus norvegicus


Alignment Length:173 Identity:88/173 - (50%)
Similarity:121/173 - (69%) Gaps:5/173 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SVNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDT 67
            :|:...|||||::|||||.|||:|::..|....|:||..:||||||.:|::|:|||.:|:|:|||
  Rat     9 TVDENVDYLFKVILIGDSNVGKTCVVQHFKSGVYSESQQNTIGVDFTVRSLEIDGKKVKMQVWDT 73

  Fly    68 AGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKK 132
            ||||||||||.||||.||..|:.||.|.:.:|.:|..|:.|||:|...|:..:|:||||||..|:
  Rat    74 AGQERFRTITQSYYRSAHAAIIAYDLTRRSTFESVPHWIHEIEKYGAANLVIMLIGNKSDLWEKR 138

  Fly   133 VV---DHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEI 172
            .|   |..|.||....|.:  ||||||.:.|:::.|:.||.|:
  Rat   139 HVLFEDACTLAEKYGLLAV--LETSAKESRNIDEVFVLMAKEL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 86/166 (52%)
Rab19NP_001019497.1 Rab19 15..179 CDD:133267 86/165 (52%)
Effector region. /evidence=ECO:0000250 46..54 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.