DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and rab1a

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001004787.1 Gene:rab1a / 448007 XenbaseID:XB-GENE-485527 Length:204 Species:Xenopus tropicalis


Alignment Length:205 Identity:174/205 - (84%)
Similarity:185/205 - (90%) Gaps:1/205 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSVNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIW 65
            |||:|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog     1 MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIW 65

  Fly    66 DTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTT 130
            |||||||||||||||||||||||||||.|||||||||||||:||:|||.|||||||||||.||||
 Frog    66 DTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTT 130

  Fly   131 KKVVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVGPPSSATDNASKVKIDQGR 195
            |||||:|||.|:|..|||||||||||:||||||||||||||||.|:||.::|......||| |..
 Frog   131 KKVVDYTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGATAGGQEKNVKI-QST 194

  Fly   196 PVENTKSGCC 205
            ||:.:..|||
 Frog   195 PVKQSSGGCC 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 153/164 (93%)
rab1aNP_001004787.1 Rab1_Ypt1 10..175 CDD:206661 153/164 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 298 1.000 Domainoid score I1434
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H36154
Inparanoid 1 1.050 333 1.000 Inparanoid score I2374
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 1 1.000 - - FOG0001193
OrthoInspector 1 1.000 - - oto103278
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X737
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.070

Return to query results.
Submit another query.