DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and rab35b

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001003548.1 Gene:rab35b / 445154 ZFINID:ZDB-GENE-040801-62 Length:201 Species:Danio rerio


Alignment Length:203 Identity:113/203 - (55%)
Similarity:143/203 - (70%) Gaps:9/203 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQE 71
            :||:|||||:|||||||||.|||||||:|::.|||:||||||||||:||:|:.:|||||||||||
Zfish     4 DYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVELNGEKVKLQIWDTAGQE 68

  Fly    72 RFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVVDH 136
            |||||||:||||.||::||||.|..|||.|||:||.||.: .|::|.::|||||:|....|||:.
Zfish    69 RFRTITSTYYRGTHGVVVVYDVTSAESFVNVKRWLHEINQ-NCDDVCRILVGNKNDDPNSKVVET 132

  Fly   137 TTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVGPPSSATDNASK----VKIDQGRPV 197
            ..|.::|.|:||...|||||...|||:.| ....|:..|....|.|.....:    :|:.|.   
Zfish   133 NDAQKFAEQMGISLFETSAKENVNVEEMF-NCITELVLRAKKESVAKQQQQQQNDVIKLKQN--- 193

  Fly   198 ENTKSGCC 205
            ...|..||
Zfish   194 SKRKKKCC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 103/164 (63%)
rab35bNP_001003548.1 P-loop_NTPase 3..201 CDD:304359 111/201 (55%)
RAB 9..170 CDD:197555 102/162 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.