DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and Rab18

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster


Alignment Length:201 Identity:77/201 - (38%)
Similarity:119/201 - (59%) Gaps:13/201 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERF 73
            |...|||:||:||||||.|:.||.::.:.:::..|||:|||.:.:::||...|:.:|||||.|||
  Fly     3 DRAIKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTAGAERF 67

  Fly    74 RTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACE-NVNKLLVGNKSDLTTKKVVDHT 137
            |::|.|:||.|.|.|:|||.|.::|...::.||.|::.|:.. |:..::||||.|  .::|||..
  Fly    68 RSLTPSFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNPNIAIIVVGNKID--EERVVDRE 130

  Fly   138 TAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKN----RVGPPSSATDNASKVKIDQGRPVE 198
            ...::|.:....|:|||||....|...|..:..:|.:    ..|..|:..|.||      .|.:|
  Fly   131 EGRKFARKHRALFIETSAKCDQFVSDVFKDVVEKIVSSEYFNNGNASAGLDIAS------DRDLE 189

  Fly   199 NTKSGC 204
            .:.|.|
  Fly   190 ASASTC 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 67/169 (40%)
Rab18NP_524744.2 RAB 6..166 CDD:197555 66/161 (41%)
Rab18 6..165 CDD:206656 66/160 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454478
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.