DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and Rab18

DIOPT Version :10

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster


Alignment Length:35 Identity:10/35 - (28%)
Similarity:13/35 - (37%) Gaps:2/35 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 FAFPRVGR--SDPELNLDWESSAMLPLETADDYED 82
            |...||.|  .|....:..:...|..:.||..|.|
  Fly    48 FVKSRVQRYSVDDSKQISKQVGYMNTVNTARVYSD 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 10/35 (29%)
Rab18NP_524744.2 Rab18 6..165 CDD:206656 10/35 (29%)

Return to query results.
Submit another query.