DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and Rab7

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster


Alignment Length:197 Identity:65/197 - (32%)
Similarity:106/197 - (53%) Gaps:26/197 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRT 75
            |.|::::|||.|||:.|:.::.:..::..|.:|||.||..:.:.::.:.:.:|||||||||||::
  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72

  Fly    76 ITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYAC----ENVNKLLVGNKSDLTTKKVVDH 136
            :..::||||...::|||.|...||.|:..|.:|....|.    ::...:::|||.||..::|...
  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTR 137

  Fly   137 TTAAEYAAQLGIPFLETSAKSATNVEQAFMTMA---------AEI-------------KNRVGPP 179
            .......::..||:.|||||...|||.||..:|         ||:             .||.|.|
  Fly   138 RAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQNNRPGNP 202

  Fly   180 SS 181
            .:
  Fly   203 DN 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 61/189 (32%)
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 58/169 (34%)
RAB 9..174 CDD:197555 58/164 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454477
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.