DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and rab1bb

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001002129.2 Gene:rab1bb / 415219 ZFINID:ZDB-GENE-040625-133 Length:201 Species:Danio rerio


Alignment Length:202 Identity:164/202 - (81%)
Similarity:179/202 - (88%) Gaps:1/202 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTA 68
            :||||||||||||||||||||||:||||||||||||:||||||||||||||||||||||||||||
Zfish     1 MNPEYDYLFKLLLIGDSGVGKSCILLRFADDTYTESFISTIGVDFKIRTIELDGKTIKLQIWDTA 65

  Fly    69 GQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKV 133
            ||||||||||||||||||||||||.|||||:|||||||:||:|||.|||||||||||.|||||||
Zfish    66 GQERFRTITSSYYRGAHGIIVVYDVTDQESYNNVKQWLKEIDRYASENVNKLLVGNKCDLTTKKV 130

  Fly   134 VDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVGPPSSATDNASKVKIDQGRPVE 198
            ||:|||.|:|..|||||||||||:||||||||||||.|||.|:.|.:|.......:|| :..||:
Zfish   131 VDYTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAEEIKKRMRPGASGGSEKPDLKI-ESTPVQ 194

  Fly   199 NTKSGCC 205
            .:..|||
Zfish   195 QSGGGCC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 149/164 (91%)
rab1bbNP_001002129.2 Rab1_Ypt1 7..172 CDD:206661 149/164 (91%)
RAB 9..172 CDD:197555 147/162 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 299 1.000 Domainoid score I1408
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 337 1.000 Inparanoid score I2355
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 1 1.000 - - FOG0001193
OrthoInspector 1 1.000 - - otm24406
orthoMCL 1 0.900 - - OOG6_101123
Panther 1 1.100 - - O PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X737
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.830

Return to query results.
Submit another query.