DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and Rab26

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster


Alignment Length:171 Identity:77/171 - (45%)
Similarity:124/171 - (72%) Gaps:2/171 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESY-ISTIGVDFKIRTIELDGKTIKLQIWDTAGQ 70
            |:|.:.|::::|||||||:.||:||.|..|..|| :||:|:||:.:.:.:||..:||||||||||
  Fly   208 EFDIMGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTAGQ 272

  Fly    71 ERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLT-TKKVV 134
            ||||::|.:|||.||.::::||.|::.:::|::.||.||..||.|:|..:|:|||:|.: :::.|
  Fly   273 ERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSGSERQV 337

  Fly   135 DHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNR 175
            ..........:..:||:|||||:..|||.:|..:|.::|:|
  Fly   338 KREDGERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSR 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 74/166 (45%)
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 75/165 (45%)
RAB 214..378 CDD:197555 74/163 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454459
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.