DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and RabX6

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster


Alignment Length:201 Identity:72/201 - (35%)
Similarity:109/201 - (54%) Gaps:20/201 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KLLLIGDSGVGKSCLLLRFADDTY-TES-YISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRT 75
            |::|.||.|||||.|..|||.:|: |:: ..||:|:|...|...::.|.||||:|||.|.||..:
  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74

  Fly    76 ITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTK--KVVDHTT 138
            :|||||:.|.|.|:|:...:..||:::.|.|.:|..|| ||....:.||||||..:  :|.|...
  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYA-ENAKIFICGNKSDLDGREPEVSDEEV 138

  Fly   139 AA--EYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVGPPSSATDNASKVKID----QGRPV 197
            .|  |....|.....:||.:|...||:.|..::.::.:.         |.||:::.    :...|
  Fly   139 EAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHA---------NRSKMELQALEHKSFQV 194

  Fly   198 ENTKSG 203
            :...||
  Fly   195 DTASSG 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 66/167 (40%)
RabX6NP_001261219.1 RAB 10..176 CDD:197555 66/166 (40%)
Rab 10..172 CDD:206640 66/162 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.