DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and Rabl6

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001102043.1 Gene:Rabl6 / 362084 RGDID:1307615 Length:731 Species:Rattus norvegicus


Alignment Length:182 Identity:38/182 - (20%)
Similarity:79/182 - (43%) Gaps:39/182 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKT----IKLQIWDTAGQ 70
            |..|:::.||...||:.|..|.....:.|.||.|  .:.::.:|..:.||    :|:::||...:
  Rat    42 YNMKIVIRGDRNTGKTALWHRLQGKKFVEEYIPT--QEIQVTSIHWNYKTTDDVVKVEVWDVVDK 104

  Fly    71 -------------------ERFRTITSSY---YRGAHGIIVVYDCTDQESFNNVKQWLEEIERYA 113
                               |....:.:.:   |:..:|:::::|.|.|.:||.|.:.|.::..: 
  Rat   105 GKCKKRGDCLKTENDPQEAESEMALDAEFLDVYKNCNGVVMMFDITKQWTFNYVLRELPKVPTH- 168

  Fly   114 CENVNKLLVGNKSDLTTKKVVDHTTAAEYAAQLGIP-------FLETSAKSA 158
               |...::||..|:...:|:......::...|..|       :.|:|.|::
  Rat   169 ---VPVCVLGNYRDMGEHRVILPDDVRDFIEHLDRPPGSSYFRYAESSMKNS 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 38/182 (21%)
Rabl6NP_001102043.1 P-loop_NTPase 44..221 CDD:304359 37/180 (21%)
Ras 45..221 CDD:278499 37/179 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.