DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and Rab32

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster


Alignment Length:189 Identity:61/189 - (32%)
Similarity:106/189 - (56%) Gaps:27/189 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSVNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTI-KLQI 64
            |:|.:.:.::|:|:|:||:.|.||:..:.|:....::::|.:||||||.::.::.|..|| :||:
  Fly   473 MTSTSDKREHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQL 537

  Fly    65 WDTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIER---------YACENVNKL 120
            ||.||||||..:|..||:.|.|..:|:|.|...:|:.|.:|.|:::.         ..|     :
  Fly   538 WDIAGQERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPC-----I 597

  Fly   121 LVGNKSD------LTTKKVVDHTTAAEYAAQLGIP-FLETSAKSATNVEQAFMTMAAEI 172
            |:.||.|      :|..:.:|     ||..:.|.. :.|||||...|:::|...:..:|
  Fly   598 LLANKCDQEKQGIITQPEKMD-----EYVRENGFAGWFETSAKENINIDEAARALVNKI 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 59/180 (33%)
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 58/178 (33%)
RAB 484..652 CDD:197555 58/178 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454483
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.