DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and Rab9

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster


Alignment Length:214 Identity:75/214 - (35%)
Similarity:113/214 - (52%) Gaps:24/214 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQ 70
            |:...|.|::::||.|||||.||.||..:.|.|:...||||:|..:.|.:||:...|||||||||
  Fly     7 PQKSKLLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAGQ 71

  Fly    71 ERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNK---LLVGNKSDL-TTK 131
            ||||.:.:.:|||:...::.|...|::|...:..|..|...||..:.:|   ::||||:|: ..|
  Fly    72 ERFRALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADVDQDKFPFIVVGNKNDIPAQK 136

  Fly   132 KVVDHTTAAEYAAQLGIP-FLETSAKSATNVEQAF---------MTMAAEIKNRVGPPSSATDNA 186
            :.|......::.|:..:. .:|||:|:||||..||         |...||.:.|....:      
  Fly   137 RQVSSDAVQQWCAEQKVACHIETSSKAATNVTDAFVLGLRQWRHMECVAEAELRQHGDT------ 195

  Fly   187 SKVKIDQGRPVENTKSGCC 205
                ||..||:...:...|
  Fly   196 ----IDLTRPIRLVQRRIC 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 68/178 (38%)
Rab9NP_609966.1 Rab9 8..178 CDD:206697 65/169 (38%)
Ras 14..177 CDD:278499 64/162 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454482
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.