DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and Rab21

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster


Alignment Length:209 Identity:76/209 - (36%)
Similarity:115/209 - (55%) Gaps:17/209 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIEL-DGKTIKLQIWDTAGQERFRT 75
            ||.:|:|:..|||:.|:||:.:|.:...::||:...|..|.:.| ||:..:|.||||||||||..
  Fly    14 FKAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQERFHA 78

  Fly    76 ITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVVDHTTAA 140
            :...||||:.|.::|||.||::||..||.|:.|:.:.....:..::||||:||..::.|.|..|.
  Fly    79 LGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTDLEEQRAVTHDEAL 143

  Fly   141 EYAAQLGIPFLETSAKSATNVEQAF----MTMAAEIKNRVGPPSSA-------TDNASKVKIDQG 194
            :||..:|..::|||||....|.:.|    ..|..::..| .|.:|.       |||.:. ..|..
  Fly   144 QYARTVGAQYVETSAKENEGVAELFELLTQLMLEQLSQR-QPDASPLRLQNPDTDNLNN-SDDSE 206

  Fly   195 RPVENTKSG---CC 205
            .|.....:|   ||
  Fly   207 APDPGDPAGQRSCC 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 65/167 (39%)
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 64/161 (40%)
Ras 15..177 CDD:278499 64/161 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454479
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.