DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and Rab9Fa

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_727471.1 Gene:Rab9Fa / 326230 FlyBaseID:FBgn0052671 Length:197 Species:Drosophila melanogaster


Alignment Length:170 Identity:72/170 - (42%)
Similarity:107/170 - (62%) Gaps:6/170 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELD----GKTIKLQIWDT 67
            :||..||::::|||||||:|||:||:|:.:|..:.||:|:|.:..::|..    |:  .||:|||
  Fly     3 QYDNPFKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGR--MLQVWDT 65

  Fly    68 AGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKK 132
            :..|||:.:.::..|.||||::|||.|..:||.|:..|::||.|...:.|..||||||||....:
  Fly    66 SDDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDDPNHR 130

  Fly   133 VVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEI 172
            .|.......||.:..|.|.|.||||..||...|.::|.:|
  Fly   131 QVSMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 70/167 (42%)
Rab9FaNP_727471.1 RAB 8..171 CDD:197555 70/165 (42%)
Rab 8..167 CDD:206640 68/160 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454305
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.