DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and Rab40

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster


Alignment Length:188 Identity:74/188 - (39%)
Similarity:110/188 - (58%) Gaps:15/188 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSVNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTES-----------YISTIGVDFKIRTIE 54
            |.::..:||||.|:||:|||.|||..:|... :|..|||           .:.|:.  :|..||.
  Fly     1 MGTMTKDYDYLLKVLLVGDSDVGKHEILSNL-EDPSTESPFCSGNDCTSHILQTVA--YKTTTIL 62

  Fly    55 LDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNK 119
            |:||.:|||:|||:||.||.||..||.|||.|||:|||.|::.||:.:.:||:|::.:| ..:.|
  Fly    63 LEGKRVKLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHA-PGIPK 126

  Fly   120 LLVGNKSDLTTKKVVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVG 177
            :||||:..|..|:.|....|..||::..:...|.|.....|:.::|..:|....:|.|
  Fly   127 VLVGNRLHLAFKRQVAAKQAETYASRNNMSCFEISPLCNFNIRESFCELARMALHRNG 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 69/175 (39%)
Rab40NP_727611.1 P-loop_NTPase 6..265 CDD:304359 73/183 (40%)
RAB 12..182 CDD:197555 67/173 (39%)
SOCS 192..234 CDD:295349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.