DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and Rab9Fb

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_727472.1 Gene:Rab9Fb / 32029 FlyBaseID:FBgn0052670 Length:214 Species:Drosophila melanogaster


Alignment Length:218 Identity:96/218 - (44%)
Similarity:132/218 - (60%) Gaps:25/218 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQE 71
            :||||||:|::||.||||||||:||:|:.:||.::.|:|:||::|.:||.|:.:.||||||||.|
  Fly     3 QYDYLFKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDE 67

  Fly    72 RFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVVDH 136
            ||:::..|||||||||::|||.|..:||.|:..||:||.|.:.|:||.:|||||.|....:.|..
  Fly    68 RFKSLLPSYYRGAHGILLVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLDNRQVRM 132

  Fly   137 TTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRV------------------GPPSSAT 183
            .....||....:.|.|.||||..||...|..::..|.||:                  .||....
  Fly   133 EQGFNYANHRALGFYEVSAKSGANVNDVFNMLSVGIYNRLVIHTPNRLSGGQETEDTAEPPDEPI 197

  Fly   184 DNASKVKIDQGRPVE-NTKSGCC 205
            :.|.|   |:.|..: ||   ||
  Fly   198 NLAGK---DRQRAKDSNT---CC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 82/164 (50%)
Rab9FbNP_727472.1 RAB 8..171 CDD:197555 80/162 (49%)
Rab 8..165 CDD:206640 79/156 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454308
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.