DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and Rab9Db

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_572642.1 Gene:Rab9Db / 31993 FlyBaseID:FBgn0030221 Length:197 Species:Drosophila melanogaster


Alignment Length:170 Identity:72/170 - (42%)
Similarity:107/170 - (62%) Gaps:6/170 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELD----GKTIKLQIWDT 67
            :||..||::::|||||||:|||:||:|:.:||.:..|:|:|.:..::|..    |:  .||:|||
  Fly     3 QYDNPFKIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMDRRECSVEFADWRMGR--MLQVWDT 65

  Fly    68 AGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKK 132
            :..|||:.:.::..|.||||::|||.|..:||.|:..|::||.|...:.|..||||||||....:
  Fly    66 SDDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDDPNHR 130

  Fly   133 VVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEI 172
            .|.......||.:..|.|.|.||||..||...|.::|.:|
  Fly   131 QVSMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 70/167 (42%)
Rab9DbNP_572642.1 RAB 8..171 CDD:197555 70/165 (42%)
Rab 8..167 CDD:206640 68/160 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454306
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.