DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and Rab27

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster


Alignment Length:196 Identity:68/196 - (34%)
Similarity:117/196 - (59%) Gaps:7/196 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGK----TIKLQIWDTAGQERF 73
            :.|::|||||||:|||.::.|..:...:|||:|:||:.:.:..:.:    .|.||||||||||||
  Fly    19 QFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDTAGQERF 83

  Fly    74 RTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYA-CENVNKLLVGNKSDLTTKKVVDHT 137
            |::|:::||.|.|.::::|.|.::||.....||.::..:| .|:.:.:|.|||.||...:||...
  Fly    84 RSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRD 148

  Fly   138 TAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVGPPSSATDNASKVKIDQGRPVENTKS 202
            ..|....:..:|::||||.:..||::|...:...:..|:  .::|.:....:.:.|.|.:.|...
  Fly   149 QVAALCRRYRLPYIETSACTGANVKEAVELLVGRVMERI--ENAACNREFSLLLTQSRCLPNIAY 211

  Fly   203 G 203
            |
  Fly   212 G 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 62/166 (37%)
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 62/167 (37%)
RAB 20..186 CDD:197555 62/165 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454484
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.