DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and Rab33b

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_058554.1 Gene:Rab33b / 19338 MGIID:1330805 Length:229 Species:Mus musculus


Alignment Length:193 Identity:78/193 - (40%)
Similarity:119/193 - (61%) Gaps:10/193 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQ 70
            |....:||:::||||.|||:||..||....:.:...:||||||:.|.:::||:.||:|:||||||
Mouse    28 PARSRIFKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDFRERAVDIDGERIKIQLWDTAGQ 92

  Fly    71 ERFR-TITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACEN-VNKLLVGNKSDLTTKKV 133
            |||| ::...|||..|.::.|||.|:..||:::..|:||.:::...| :.::|||||.||.:...
Mouse    93 ERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPAWIEECKQHLLANDIPRILVGNKCDLRSAIQ 157

  Fly   134 VDHTTAAEYAAQLGIPFLETSAKSAT---NVEQAFMTMAAEIKNRVGPP---SSATDNASKVK 190
            |....|.::|....:|..|||||:..   :||..|||:|.::|:.  .|   |...||...:|
Mouse   158 VPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSH--KPLMLSQLPDNRISLK 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 72/169 (43%)
Rab33bNP_058554.1 Rab33B_Rab33A 32..201 CDD:133315 71/168 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.