DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and Rab19

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_035356.1 Gene:Rab19 / 19331 MGIID:103292 Length:217 Species:Mus musculus


Alignment Length:206 Identity:95/206 - (46%)
Similarity:134/206 - (65%) Gaps:13/206 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERF 73
            |||||::|||||.|||:|::..|....|:||..:||||||.:|::|:|||.:|:|:|||||||||
Mouse    15 DYLFKVILIGDSNVGKTCVVQHFKSGVYSESQQNTIGVDFTVRSLEIDGKKVKMQVWDTAGQERF 79

  Fly    74 RTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVV---D 135
            ||||.||||.||..|:.||.|.:.:|.:|..|:.|||:|...|:..:|:||||||..|:.|   |
Mouse    80 RTITQSYYRSAHAAIIAYDLTRRSTFESVPHWIHEIEKYGAANLVIMLIGNKSDLWEKRHVLFED 144

  Fly   136 HTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEI--KNRV-----GPPSSATDNASKVKIDQ 193
            ..|.||....|.:  ||||||.:.|:::.|:.||.|:  :|.:     ......:.::|.|.:.|
Mouse   145 ACTLAEKHGLLAV--LETSAKESRNIDEVFVLMAKELIARNSLHLYGESAQQGLSQDSSPVLVAQ 207

  Fly   194 GRPVENTKSGC 204
             .|.|:|:..|
Mouse   208 -VPNESTRCTC 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 86/169 (51%)
Rab19NP_035356.1 Rab19 15..179 CDD:133267 86/165 (52%)
RAB 18..182 CDD:197555 84/165 (51%)
Effector region. /evidence=ECO:0000250 46..54 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.