DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and F08G12.1

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_509888.1 Gene:F08G12.1 / 181320 WormBaseID:WBGene00008585 Length:635 Species:Caenorhabditis elegans


Alignment Length:160 Identity:36/160 - (22%)
Similarity:64/160 - (40%) Gaps:56/160 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YLFKLLLIGDSGVGKSCLLLRFADDTYTESYIST-----IGVDFKIRTIELDGKTIKLQIW---- 65
            |..|:::.||..|||:||..|....::.|.|::|     ..:::..|..:   ..:|:.:|    
 Worm    42 YNLKIVIRGDRNVGKTCLWKRLQGLSFQEEYVATEEIQVANINWNYRATD---DVVKVDVWDIVD 103

  Fly    66 ----------------------------DTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNV 102
                                        |||...||..:    |:|.:|:|.|:|.|        
 Worm   104 QSTKKRVKDDKLKLANNGMDKNDGLDYEDTACDARFVDV----YKGTNGVIFVFDIT-------- 156

  Fly   103 KQWL-EEIERYACENVNK---LLVGNKSDL 128
            |.|. |.:::...:..||   |::.|:.|:
 Worm   157 KTWTWEYVQKEIVKVPNKIPVLVLANRRDM 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 36/160 (23%)
F08G12.1NP_509888.1 P-loop_NTPase 44..>193 CDD:304359 35/158 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.