DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and K02E10.1

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_508455.2 Gene:K02E10.1 / 180554 WormBaseID:WBGene00019317 Length:218 Species:Caenorhabditis elegans


Alignment Length:212 Identity:88/212 - (41%)
Similarity:140/212 - (66%) Gaps:19/212 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQER 72
            |::|||::::||...||||:|||||::::...:|||:|||||::||:|....|:|::|||||.||
 Worm     3 YNHLFKIVVVGDHNCGKSCILLRFAENSFRMDHISTLGVDFKLKTIKLGRDKIRLELWDTAGMER 67

  Fly    73 FRTITSSYYRGAHGIIVVYDCTDQESFNNV-KQWLEEIERYACENVNKLLVGNKSDLTTKKVVDH 136
            :|||.:|||..|||::.|||.|:::||.|: |.||:||:::|..|...:|||||:|:..::.||.
 Worm    68 YRTIYNSYYHSAHGVMCVYDMTNEKSFENLEKYWLKEIKQHAPPNAVLMLVGNKADMDQERKVDF 132

  Fly   137 TTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVGPPSSATDNASK------------- 188
            ..|.:.|::||:...|.|||:..|.|:||.|:.|.::.|:...|..:|.:..             
 Worm   133 DRAEKLASRLGVSLYEVSAKTGINCEEAFHTLTAAMRERITAGSMHSDESDDNEEFSSAFHVDGV 197

  Fly   189 VKIDQGRPVENTKSGCC 205
            :|.|:|:     .:.||
 Worm   198 IKSDKGK-----FTSCC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 79/165 (48%)
K02E10.1NP_508455.2 Rab 7..165 CDD:206640 77/157 (49%)
RAB 7..164 CDD:197555 76/156 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.