DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and rab-1

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_503397.1 Gene:rab-1 / 178620 WormBaseID:WBGene00004266 Length:205 Species:Caenorhabditis elegans


Alignment Length:206 Identity:166/206 - (80%)
Similarity:184/206 - (89%) Gaps:2/206 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSVNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIW 65
            |:::|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Worm     1 MAAMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIW 65

  Fly    66 DTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTT 130
            |||||||||||||||||||||||||||.||||:||||||||:||:|||||||||||||||.|||.
 Worm    66 DTAGQERFRTITSSYYRGAHGIIVVYDITDQETFNNVKQWLQEIDRYACENVNKLLVGNKCDLTA 130

  Fly   131 KKVVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVGPPSSATDNASKVKIDQGR 195
            |:.|:...|.:||.|||||||||||||:|||||||:|||:|||:|:||...| ..|..|:|...:
 Worm   131 KRAVETQAAQDYAGQLGIPFLETSAKSSTNVEQAFLTMASEIKSRMGPVQGA-GGAPGVRITGSQ 194

  Fly   196 PVENTKS-GCC 205
            ||::.|| |||
 Worm   195 PVQDKKSGGCC 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 146/164 (89%)
rab-1NP_503397.1 Rab1_Ypt1 10..175 CDD:206661 146/164 (89%)
RAB 12..175 CDD:197555 144/162 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 290 1.000 Domainoid score I838
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H36154
Inparanoid 1 1.050 332 1.000 Inparanoid score I1428
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53521
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 1 1.000 - - FOG0001193
OrthoInspector 1 1.000 - - oto18237
orthoMCL 1 0.900 - - OOG6_101123
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1997
SonicParanoid 1 1.000 - - X737
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.910

Return to query results.
Submit another query.