DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and rab-3

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001021973.1 Gene:rab-3 / 173971 WormBaseID:WBGene00004267 Length:233 Species:Caenorhabditis elegans


Alignment Length:158 Identity:82/158 - (51%)
Similarity:119/158 - (75%) Gaps:0/158 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQER 72
            :||:||||:||:|.|||:..|.|:.||::|.:::||:|:|||::|:....|.:||||||||||||
 Worm    33 FDYMFKLLIIGNSSVGKTSFLFRYCDDSFTSAFVSTVGIDFKVKTVFRGDKRVKLQIWDTAGQER 97

  Fly    73 FRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVVDHT 137
            :||||::|||||.|.|::||.|::||||:|:.|..:|:.|:.||...:|||||.|:.:::||...
 Worm    98 YRTITTAYYRGAMGFILMYDITNEESFNSVQDWCTQIKTYSWENAQVVLVGNKCDMDSERVVSMD 162

  Fly   138 TAAEYAAQLGIPFLETSAKSATNVEQAF 165
            ...:.|.|||:.|.|||||...||:..|
 Worm   163 RGRQLADQLGLEFFETSAKENINVKAVF 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 81/156 (52%)
rab-3NP_001021973.1 Rab3 36..200 CDD:206657 80/155 (52%)
RAB 37..197 CDD:197555 80/154 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.