DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and Rab3c

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_598220.1 Gene:Rab3c / 171058 RGDID:620923 Length:227 Species:Rattus norvegicus


Alignment Length:207 Identity:92/207 - (44%)
Similarity:134/207 - (64%) Gaps:6/207 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SVNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDT 67
            |.:..:||:||||:||:|.|||:..|.|:|||::|.:::||:|:|||::|:..:.|.||||||||
  Rat    22 SSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDT 86

  Fly    68 AGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKK 132
            |||||:||||::|||||.|.|::||.|::||||.|:.|..:|:.|:.:|...:|||||.|:..::
  Rat    87 AGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDER 151

  Fly   133 VVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVGPPSSATDNA-----SKVKID 192
            ||..........|||..|.|||||...||:|.|..:...|.:::. .|..||.|     ...::.
  Rat   152 VVSTERGRHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMS-ESLETDPAITGAKQSTRLK 215

  Fly   193 QGRPVENTKSGC 204
            :..|......||
  Rat   216 ETPPPPQPNCGC 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 83/164 (51%)
Rab3cNP_598220.1 Rab3 30..194 CDD:206657 82/163 (50%)
RAB 31..191 CDD:197555 81/159 (51%)
Effector region. /evidence=ECO:0000250 59..67 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..227 3/24 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.