DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and Rab3d

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_006242655.1 Gene:Rab3d / 140665 RGDID:620924 Length:239 Species:Rattus norvegicus


Alignment Length:206 Identity:90/206 - (43%)
Similarity:130/206 - (63%) Gaps:4/206 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SVNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDT 67
            :.:..:||:|||||||:|.|||:..|.|:|||::|.:::||:|:|||::|:....|.||||||||
  Rat    34 AADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDT 98

  Fly    68 AGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKK 132
            |||||:||||::|||||.|.:::||..:||||..|:.|..:|:.|:.:|...:|||||.||..::
  Rat    99 AGQERYRTITTAYYRGAMGFLLMYDIANQESFTAVQDWATQIKTYSWDNAQVILVGNKCDLEDER 163

  Fly   133 VVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVG----PPSSATDNASKVKIDQ 193
            ||........|..||..|.|.|||...||:|.|..:...|.:::.    |.||...|.....:..
  Rat   164 VVSAEDGQRLAGDLGFEFFEASAKENINVKQVFERLVDIICDKMNESLEPSSSPGSNGKGPALGD 228

  Fly   194 GRPVENTKSGC 204
            ..|.:.:..||
  Rat   229 TPPPQPSSCGC 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 82/164 (50%)
Rab3dXP_006242655.1 Rab3 42..206 CDD:206657 81/163 (50%)
RAB 43..203 CDD:197555 80/159 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.