Sequence 1: | NP_732610.1 | Gene: | Rab1 / 42524 | FlyBaseID: | FBgn0285937 | Length: | 205 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_612462.1 | Gene: | RAB3C / 115827 | HGNCID: | 30269 | Length: | 227 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 89/203 - (43%) |
---|---|---|---|
Similarity: | 133/203 - (65%) | Gaps: | 6/203 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 SVNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDT 67
Fly 68 AGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKK 132
Fly 133 VVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVG------PPSSATDNASKVKI 191
Fly 192 DQGRPVEN 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab1 | NP_732610.1 | Rab1_Ypt1 | 10..175 | CDD:206661 | 82/164 (50%) |
RAB3C | NP_612462.1 | Rab3 | 30..194 | CDD:206657 | 81/163 (50%) |
Effector region. /evidence=ECO:0000250 | 59..67 | 3/7 (43%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |