DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and RAB10

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_057215.3 Gene:RAB10 / 10890 HGNCID:9759 Length:200 Species:Homo sapiens


Alignment Length:200 Identity:110/200 - (55%)
Similarity:143/200 - (71%) Gaps:7/200 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQER 72
            ||.||||||||||||||:|:|.||:||.:..::|||||:||||:|:||.||.|||||||||||||
Human     6 YDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQER 70

  Fly    73 FRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVVDHT 137
            |.|||:||||||.||::|||.|:.:||.|:.:||..|:.:|.|:|.::|:|||.|:..|:||...
Human    71 FHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKG 135

  Fly   138 TAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEI--KNRVGPPSSATDNASKVKIDQGRPVENT 200
            ...:.|.:.||.|.|||||:..|:|:||:|:|.:|  |..|..|     |:..|.|..|..|...
Human   136 KGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEP-----NSENVDISSGGGVTGW 195

  Fly   201 KSGCC 205
            ||.||
Human   196 KSKCC 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 97/166 (58%)
RAB10NP_057215.3 Rab8_Rab10_Rab13_like 7..173 CDD:206659 97/165 (59%)
Effector region. /evidence=ECO:0000250 38..46 5/7 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.