DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and Rab1b

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001103449.1 Gene:Rab1b / 100126191 RGDID:1642882 Length:201 Species:Rattus norvegicus


Alignment Length:202 Identity:167/202 - (82%)
Similarity:182/202 - (90%) Gaps:1/202 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTA 68
            :||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat     1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTA 65

  Fly    69 GQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKV 133
            ||||||||||||||||||||||||.|||||:.||||||:||:|||.|||||||||||||||||||
  Rat    66 GQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKV 130

  Fly   134 VDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVGPPSSATDNASKVKIDQGRPVE 198
            ||:|||.|:|..||:||||||||:||||||||||||||||.|:||.:::......:||| ..||:
  Rat   131 VDNTTAKEFADSLGVPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKID-STPVK 194

  Fly   199 NTKSGCC 205
            :...|||
  Rat   195 SASGGCC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 151/164 (92%)
Rab1bNP_001103449.1 Rab1_Ypt1 7..172 CDD:206661 151/164 (92%)
Effector region. /evidence=ECO:0000255 37..45 7/7 (100%)
Switch 2 region, required for interaction with REP1/CHM. /evidence=ECO:0000250|UniProtKB:Q9H0U4 64..83 18/18 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..201 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 297 1.000 Domainoid score I1406
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 341 1.000 Inparanoid score I2277
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 1 1.000 - - FOG0001193
OrthoInspector 1 1.000 - - otm45140
orthoMCL 1 0.900 - - OOG6_101123
Panther 1 1.100 - - O PTHR24073
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X737
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.