DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab1 and zgc:171927

DIOPT Version :9

Sequence 1:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001096112.1 Gene:zgc:171927 / 100124616 ZFINID:ZDB-GENE-070822-21 Length:210 Species:Danio rerio


Alignment Length:210 Identity:152/210 - (72%)
Similarity:174/210 - (82%) Gaps:8/210 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTA 68
            :||||||||||||||||||||||||||||||||||||||||||||||||||::|||:||||||||
Zfish     1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIEMEGKTVKLQIWDTA 65

  Fly    69 GQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKV 133
            ||||||||||||||||||||:|||.|:||||||||||||||:|||||||:||||||||||::|||
Zfish    66 GQERFRTITSSYYRGAHGIIIVYDVTEQESFNNVKQWLEEIDRYACENVSKLLVGNKSDLSSKKV 130

  Fly   134 VDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVGPPSSATD--------NASKVK 190
            ||.|||.|:...|.||.||||||:|.|||:||:.||:||:.|:|..|...:        |::.:.
Zfish   131 VDFTTAMEFTESLKIPLLETSAKNANNVEKAFLAMASEIQKRIGADSVQNETVKIGSKINSAPLW 195

  Fly   191 IDQGRPVENTKSGCC 205
            ....:.|....|.||
Zfish   196 PGAEKSVAEEVSSCC 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 139/164 (85%)
zgc:171927NP_001096112.1 Rab1_Ypt1 7..172 CDD:206661 139/164 (85%)
RAB 9..172 CDD:197555 137/162 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 1 1.000 - - FOG0001193
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X737
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.