DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ETHR and trhra

DIOPT Version :9

Sequence 1:NP_001287439.1 Gene:ETHR / 42523 FlyBaseID:FBgn0038874 Length:471 Species:Drosophila melanogaster
Sequence 2:XP_687246.4 Gene:trhra / 558878 ZFINID:ZDB-GENE-100922-18 Length:393 Species:Danio rerio


Alignment Length:323 Identity:105/323 - (32%)
Similarity:168/323 - (52%) Gaps:39/323 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RTTAMFFCIVIMLLGVVGNVMVPIVIVKTKDMRNSTNIFLTNLSIADLLVLLVCTPTVLVEVNTR 74
            :..::...|:|..:|:||||||.:|::.||.||..||.:|.:|::|||:||.......:.|:...
Zfish    19 KVVSILLVILICGVGIVGNVMVILVVLTTKHMRTPTNCYLVSLAVADLMVLTAAGLPNITEILFG 83

  Fly    75 PETWVLGHEMCKAVPFVELTVAHASVLTILAISFERYYAICEPLKAGYVCTKGRAILICVLAWGI 139
            .: ||.|:..|.::.:.:....:||..:|.|.:.|||.|||.|:||.::||..||..|.||.|.:
Zfish    84 GQ-WVYGYAGCLSITYFQYLGINASSCSITAFTIERYIAICHPIKAQFMCTLSRAKKIIVLVWVL 147

  Fly   140 AALFTSPILWVAEYKLAEYI-DGSSVAVCLTQAISDWTLAFFLMTISVFFVVPFVTLVVLYGIIA 203
            .:|:.  ::|.......|.: |.:.:..|..:...:..|..:....:||:|:|.:...||||:||
Zfish   148 TSLYC--VMWFYLLDTREKVYDNAVLVTCGYKVSRELYLPIYFTDYAVFYVIPLLLATVLYGLIA 210

  Fly   204 RNLVSNRAAMLRARPTKPELS----------------------LKARKQVVLMLGAVVLSFFVCL 246
            |.|      .|...|:.|:.|                      :.:|:||..||..||:.|.:..
Zfish   211 RIL------FLNPLPSDPKESRRNWKKESSVHGNSRSSSNSTTVASRRQVTKMLAVVVILFALLW 269

  Fly   247 LPFRVLTLWIILSTDQTLHDLGLVRYYSLLYFCRIMLYLNSAMNPILYNLMSTKFRRGFKRLC 309
            :|:|.|.:     .:..|.:..|...:  |.|||:.:|:|||:|||:||.||.|||..|.:||
Zfish   270 MPYRTLVV-----VNSFLKEAYLDTCF--LLFCRLCIYMNSAINPIIYNAMSQKFRAAFHKLC 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ETHRNP_001287439.1 7tm_4 18..>143 CDD:304433 49/124 (40%)
7tm_1 27..294 CDD:278431 91/289 (31%)
7tm_4 <102..307 CDD:304433 73/227 (32%)
trhraXP_687246.4 7tm_4 28..>171 CDD:304433 52/145 (36%)
7tm_1 36..310 CDD:278431 91/289 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BFHW
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I4086
OMA 1 1.010 - - QHG46032
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002547
OrthoInspector 1 1.000 - - otm24868
orthoMCL 1 0.900 - - OOG6_104289
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4203
SonicParanoid 1 1.000 - - X1670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.