DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ETHR and Mlnr

DIOPT Version :9

Sequence 1:NP_001287439.1 Gene:ETHR / 42523 FlyBaseID:FBgn0038874 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_852029.3 Gene:Mlnr / 252859 RGDID:621262 Length:352 Species:Rattus norvegicus


Alignment Length:331 Identity:107/331 - (32%)
Similarity:162/331 - (48%) Gaps:54/331 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IPSYIRTTAMFFCIVIMLLGVVGNVMVPIVIVKTKDMRNSTNIFLTNLSIADLLVLLVC-TPTVL 68
            :|.| :..::|..:::..||:|||.||.:|::.::||...||.:|.:|::|||||||.. .|.| 
  Rat    18 LPEY-KVVSVFLVLLVCTLGIVGNAMVILVVLTSRDMHTPTNCYLVSLALADLLVLLAAGLPNV- 80

  Fly    69 VEVNTRPETWVLGHEMCKAVPFVELTVAHASVLTILAISFERYYAICEPLKAGYVCTKGRAILIC 133
              .::....|:.|...|..:.:.:....:.|..:|||.:.|||.|||.||:|..|||..||..|.
  Rat    81 --SDSLVGHWIYGRAGCLGITYFQYLGINVSSFSILAFTVERYIAICHPLRAQTVCTVARAKRII 143

  Fly   134 VLAWGIAALFTSPILWVAEYKLAEY-IDGSSVAVCLTQAISDWTLAFFLMTISVFFVVPFVTLVV 197
            ...||:.:|:.  :||   :.|.:. :..:....|..:......|..:|:..:|||:.|.:..:|
  Rat   144 AGIWGVTSLYC--LLW---FFLVDLNVRDNQRLECGYKVPRGLYLPIYLLDFAVFFIGPLLVTLV 203

  Fly   198 LYGIIARNL----VSNRA--------AMLRARPTKPELSLKARKQVVLMLGAVVLSFFVCLLPFR 250
            |||:|.|.|    :|..|        ....|.|.....:..:|||...||..|||.|.|...|:|
  Rat   204 LYGLIGRILFQSPLSQEAWQKERQPHGQSEAAPGNCSRAKSSRKQATRMLAVVVLLFAVLWTPYR 268

  Fly   251 VLTL------------WIILSTDQTLHDLGLVRYYSLLYFCRIMLYLNSAMNPILYNLMSTKFRR 303
            .|.|            |::|                   |||..:|.|||:||::|:|||.|||.
  Rat   269 TLVLLNSFVAQPFLDPWVLL-------------------FCRTCVYTNSAVNPVVYSLMSQKFRA 314

  Fly   304 GFKRLC 309
            .|.:||
  Rat   315 AFLKLC 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ETHRNP_001287439.1 7tm_4 18..>143 CDD:304433 47/125 (38%)
7tm_1 27..294 CDD:278431 91/292 (31%)
7tm_4 <102..307 CDD:304433 75/229 (33%)
MlnrNP_852029.3 7tm_4 37..>161 CDD:304433 48/131 (37%)
7tm_1 39..305 CDD:278431 91/292 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4666
eggNOG 1 0.900 - - E33208_3BFHW
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4038
OMA 1 1.010 - - QHG46032
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002547
OrthoInspector 1 1.000 - - otm46368
orthoMCL 1 0.900 - - OOG6_104289
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.