DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ETHR and NMUR1

DIOPT Version :9

Sequence 1:NP_001287439.1 Gene:ETHR / 42523 FlyBaseID:FBgn0038874 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_006047.3 Gene:NMUR1 / 10316 HGNCID:4518 Length:426 Species:Homo sapiens


Alignment Length:332 Identity:101/332 - (30%)
Similarity:159/332 - (47%) Gaps:61/332 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IVIMLLGVVGNVMVPIVIVKTKDMRNSTNIFLTNLSIADLLVLLVCTPTVLVEV-NTRPETWVLG 81
            ::|.::|.|||.:..:||::.|.||..||.:|.:|:::|||||||..|..|.|: :..|  ::||
Human    68 LLIFVVGAVGNGLTCLVILRHKAMRTPTNYYLFSLAVSDLLVLLVGLPLELYEMWHNYP--FLLG 130

  Fly    82 HEMCKAVPFVELTVAHASVLTILAISFERYYAICEPLKAGYVCTKGRAILICVLAWGIAALFTSP 146
            ...|.....:...|..||||.:.|:|.|||.|:..||:|..:.|:.....:....||:|.|.:.|
Human   131 VGGCYFRTLLFEMVCLASVLNVTALSVERYVAVVHPLQARSMVTRAHVRRVLGAVWGLAMLCSLP 195

  Fly   147 ILWVAEYKLAEYIDGSSV-----------------AVCL---TQAISDWTLAFFLMTISVFFVVP 191
                          .:|:                 |||:   .:|:.:..:.   .|..:||.:|
Human   196 --------------NTSLHGIRQLHVPCRGPVPDSAVCMLVRPRALYNMVVQ---TTALLFFCLP 243

  Fly   192 FVTLVVLYGIIARNLVSNR-----------AAMLRARPT-KPELSLKARKQVVLMLGAVVLSFFV 244
            ...:.|||.:|...|...|           :|..|:|.| :.:...:.|:||..||..:|:.|.:
Human   244 MAIMSVLYLLIGLRLRRERLLLMQEAKGRGSAAARSRYTCRLQQHDRGRRQVTKMLFVLVVVFGI 308

  Fly   245 CLLPFRV-LTLWIILS--TDQTLHDLGLVRYYSLLYFCRIMLYLNSAMNPILYNLMSTKFRRGFK 306
            |..||.. ..:|.::|  || .||    :.:..:.....|..||.||.||:||:|||::||..|:
Human   309 CWAPFHADRVMWSVVSQWTD-GLH----LAFQHVHVISGIFFYLGSAANPVLYSLMSSRFRETFQ 368

  Fly   307 R-LCQDA 312
            . ||..|
Human   369 EALCLGA 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ETHRNP_001287439.1 7tm_4 18..>143 CDD:304433 46/125 (37%)
7tm_1 27..294 CDD:278431 87/302 (29%)
7tm_4 <102..307 CDD:304433 65/239 (27%)
NMUR1NP_006047.3 7tm_1 77..356 CDD:278431 87/302 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5416
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.