DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3337 and PRMT9

DIOPT Version :9

Sequence 1:NP_001303427.1 Gene:CG3337 / 42519 FlyBaseID:FBgn0038871 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_612373.2 Gene:PRMT9 / 90826 HGNCID:25099 Length:845 Species:Homo sapiens


Alignment Length:123 Identity:31/123 - (25%)
Similarity:50/123 - (40%) Gaps:34/123 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LLDIGSGDGRIVVAAAQHCGALKADGVELNPWL-------VYYSRLAA---LRHSVSKRTRFFRR 134
            :||||:|.| |:...|:..||......||:..:       |..:::.|   |.|     |:....
Human   181 VLDIGAGTG-ILSMFAKKAGAHSVYACELSKTMYELACDVVAANKMEAGIKLLH-----TKSLDI 239

  Fly   135 DLWKFDIKDYNFVV-------IFG---VEQMMQDLEHKLI--------AECPHNTKII 174
            ::.|...:..:.||       :||   ||.::...||.|:        |.|....|:|
Human   240 EIPKHIPERVSLVVTETVDAGLFGEGIVESLIHAWEHLLLQPKTKGESANCEKYGKVI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3337NP_001303427.1 Methyltransf_18 78..167 CDD:289607 28/114 (25%)
PRMT9NP_612373.2 TPR 1 25..58
TPR <39..144 CDD:223533
TPR 2 67..100
TPR repeat 68..95 CDD:276809
TPR repeat 100..130 CDD:276809
TPR 3 101..134
AdoMet_MTases 148..>303 CDD:327401 31/123 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.