DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3337 and HMT1

DIOPT Version :9

Sequence 1:NP_001303427.1 Gene:CG3337 / 42519 FlyBaseID:FBgn0038871 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_009590.1 Gene:HMT1 / 852322 SGDID:S000000238 Length:348 Species:Saccharomyces cerevisiae


Alignment Length:209 Identity:43/209 - (20%)
Similarity:64/209 - (30%) Gaps:96/209 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 IQNVLSFLPKNSAGKLLDIGSGDGRIVVAAAQHCGALKADG-------------VELN------- 109
            |||...|..|    .:||:|.|.|.:.:.||:| ||....|             ||||       
Yeast    51 IQNKDLFKDK----IVLDVGCGTGILSMFAAKH-GAKHVIGVDMSSIIEMAKELVELNGFSDKIT 110

  Fly   110 ---------------------PWLVY------------YSR------------------LAALRH 123
                                 .|:.|            |:|                  ||.|..
Yeast   111 LLRGKLEDVHLPFPKVDIIISEWMGYFLLYESMMDTVLYARDHYLVEGGLIFPDKCSIHLAGLED 175

  Fly   124 SVSKRTRF-FRRDLWKFDIKDYNFVVIFGVEQMMQDLEHKLIAECPHNTKIIACRFPLPSLEHVK 187
            |..|..:. :.:|::.||...:..:|:           |:.|.:......:        :....|
Yeast   176 SQYKDEKLNYWQDVYGFDYSPFVPLVL-----------HEPIVDTVERNNV--------NTTSDK 221

  Fly   188 IIEDGVNTVWFYDL 201
            :||..:|||...||
Yeast   222 LIEFDLNTVKISDL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3337NP_001303427.1 Methyltransf_18 78..167 CDD:289607 30/160 (19%)
HMT1NP_009590.1 AdoMet_MTases <56..>130 CDD:418430 17/78 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.