DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3337 and GSTCD

DIOPT Version :9

Sequence 1:NP_001303427.1 Gene:CG3337 / 42519 FlyBaseID:FBgn0038871 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001026890.2 Gene:GSTCD / 79807 HGNCID:25806 Length:633 Species:Homo sapiens


Alignment Length:217 Identity:37/217 - (17%)
Similarity:62/217 - (28%) Gaps:98/217 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PLAKTPKSGMSTGGKILIAATGGVGIGLSIVCASFVAPAFRRICLPYVPATTEQIQNVLSFLPKN 75
            |.|.:||.|..:..:                       |.|:          :|..|.|.::..|
Human   406 PAAVSPKEGKMSSDR-----------------------ALRK----------QQQLNNLVYVVTN 437

  Fly    76 SA---GKLLDIGSGDGRIVVAAAQ---HCGALKADGVEL---------------NPWLV-----Y 114
            .|   .:::|..||.|.:.:..|.   .|.....:..||               |.|.:     |
Human   438 QAKPGDRIVDFCSGGGHVGIVLAHMLPSCQVTLIENKELSLIRAKKRSDELGLSNIWFIQANMEY 502

  Fly   115 YSRL---------------AALRHSVSKRTRF--------FRRDLWKFDIKDYNFVVIFGVEQMM 156
            ::.:               ..:.|.:..|..|        |.::..||:...        .||..
Human   503 FTGMFNIGVALHACGVATDMVIEHCIKTRASFVTCPCCYGFIQNTSKFNFPK--------SEQFK 559

  Fly   157 QDLEHKLIAECPHNTKIIACRF 178
            :.|.:|        ..:|.|||
Human   560 KTLSYK--------EHMILCRF 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3337NP_001303427.1 Methyltransf_18 78..167 CDD:289607 21/134 (16%)
GSTCDNP_001026890.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..233
GST_C_family <270..329 CDD:351885
AdoMet_MTases 423..541 CDD:354317 20/127 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.