DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3337 and Mettl27

DIOPT Version :9

Sequence 1:NP_001303427.1 Gene:CG3337 / 42519 FlyBaseID:FBgn0038871 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_006504585.1 Gene:Mettl27 / 79565 MGIID:1933146 Length:266 Species:Mus musculus


Alignment Length:109 Identity:25/109 - (22%)
Similarity:47/109 - (43%) Gaps:25/109 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LLDIGSGDGRIVVAAAQHCGALKADGVELNPWLVYYSRLAALRHSVSKRTRFFRRDLWKFDIKD- 143
            :||:..|.| :|....|..|.|:..||:.:|.::..:|...|.|.:|..|      |.:..:.| 
Mouse    71 ILDVACGTG-LVAVELQARGFLQVQGVDGSPEMLKQARARGLYHHLSLCT------LGQEPLPDP 128

  Fly   144 ---YNFVVIFG-----------VEQMMQDLEHKLIAECPHNTKI 173
               ::.|:|.|           :.::::..:.   ..|||.|.:
Mouse   129 EGTFDAVIIVGALSEGQVPCSAIPELLRVTKP---GSCPHQTTV 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3337NP_001303427.1 Methyltransf_18 78..167 CDD:289607 21/101 (21%)
Mettl27XP_006504585.1 AdoMet_MTases 31..>103 CDD:388410 11/32 (34%)
Methyltransf_25 71..161 CDD:379312 21/99 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.