DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3337 and Prmt3

DIOPT Version :9

Sequence 1:NP_001303427.1 Gene:CG3337 / 42519 FlyBaseID:FBgn0038871 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_598501.1 Gene:Prmt3 / 71974 MGIID:1919224 Length:528 Species:Mus musculus


Alignment Length:185 Identity:33/185 - (17%)
Similarity:59/185 - (31%) Gaps:85/185 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LLDIGSGDGRIVVAAAQHCGALKADGVE------------------------------------- 107
            :||:|.|.|.:.:.||: .||.|...|:                                     
Mouse   256 VLDVGCGTGILSMFAAK-VGAKKVIAVDQSEILYQAMDIIRLNKLEDTIVLIKGKIEEVSLPVEK 319

  Fly   108 ----LNPWLVYY----SRLAALRHSVSK----------------------------RTRFFRRDL 136
                ::.|:.|:    |.|.::.::.||                            |..|: .|:
Mouse   320 VDVIISEWMGYFLLFESMLDSVLYAKSKYLAKGGSVYPDICTISLVAVSDVSKHADRIAFW-DDV 383

  Fly   137 WKFDIKDYNFVVIFGVEQMMQDLEHKLIAECPHNTKIIACRFPLPSLEHVKIIED 191
            :.|::......||  .|.:::.::||.:...|.:.|.|.|        |...|.|
Mouse   384 YGFNMSCMKKAVI--PEAVVEVVDHKTLISDPCDIKHIDC--------HTTSISD 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3337NP_001303427.1 Methyltransf_18 78..167 CDD:289607 26/159 (16%)
Prmt3NP_598501.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
zf-C2H2_2 48..>97 CDD:289522
AdoMet_MTases 256..356 CDD:100107 17/100 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.