DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3337 and Gstcd

DIOPT Version :9

Sequence 1:NP_001303427.1 Gene:CG3337 / 42519 FlyBaseID:FBgn0038871 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001343238.1 Gene:Gstcd / 67553 MGIID:1914803 Length:634 Species:Mus musculus


Alignment Length:218 Identity:41/218 - (18%)
Similarity:63/218 - (28%) Gaps:100/218 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PLAKTPKSG-MSTGGKILIAATGGVGIGLSIVCASFVAPAFRRICLPYVPATTEQIQNVLSFLPK 74
            |.|.:||.| |||.                        .|.|:          :|..|.|.:|..
Mouse   407 PAAVSPKEGKMSTD------------------------RALRK----------QQQLNNLVYLVL 437

  Fly    75 NSA---GKLLDIGSGDGRIVVAAAQ---HCGALKADGVEL---------------NPWLV----- 113
            |.|   .:::|..||.|.:.:..|.   .|.....:..||               |.|.:     
Mouse   438 NQAKPGDRIVDFCSGGGHVGIVLAHMLPSCQVTLIENKELSLIRAKKRSDELGLSNIWFIQANME 502

  Fly   114 YYSRL---------------AALRHSVSKRTRF--------FRRDLWKFDIKDYNFVVIFGVEQM 155
            |::.:               ..:.|.:..|..|        |.::..||     ||......::.
Mouse   503 YFTGMFNIGVALHACGVATDMVIEHCIQTRASFITCPCCYGFIQNTSKF-----NFPKSEKFKKT 562

  Fly   156 MQDLEHKLIAECPHNTKIIACRF 178
            :...||.|:           |||
Mouse   563 LSYKEHMLL-----------CRF 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3337NP_001303427.1 Methyltransf_18 78..167 CDD:289607 22/134 (16%)
GstcdNP_001343238.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..233
GST_C_family <271..330 CDD:322082
AdoMet_MTases 424..542 CDD:327401 21/127 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.