powered by:
Protein Alignment CG3337 and Prmt1
DIOPT Version :9
Sequence 1: | NP_001303427.1 |
Gene: | CG3337 / 42519 |
FlyBaseID: | FBgn0038871 |
Length: | 204 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006229206.1 |
Gene: | Prmt1 / 60421 |
RGDID: | 62020 |
Length: | 371 |
Species: | Rattus norvegicus |
Alignment Length: | 50 |
Identity: | 17/50 - (34%) |
Similarity: | 28/50 - (56%) |
Gaps: | 4/50 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 80 LLDIGSGDGRIVVAAAQHCGALKADGVE---LNPWLVYYSRLAALRHSVS 126
:||:|||.|.:.:.||: .||.|..|:| ::.:.|...:...|.|.|:
Rat 92 VLDVGSGTGILCMFAAK-AGARKVIGIECSSISDYAVKIVKANKLDHVVT 140
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0500 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.