DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3337 and mettl7a.2

DIOPT Version :9

Sequence 1:NP_001303427.1 Gene:CG3337 / 42519 FlyBaseID:FBgn0038871 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_021327508.1 Gene:mettl7a.2 / 569089 ZFINID:ZDB-GENE-120215-62 Length:242 Species:Danio rerio


Alignment Length:132 Identity:29/132 - (21%)
Similarity:54/132 - (40%) Gaps:32/132 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 EQIQNVLSFLPKNSAGKLLDIGSGDGRIVVAAAQH--CGALKADGVELNPWLVYYSRLAALRHSV 125
            |..:|:..|.|...:.::|::|.|.|    |..:|  .|: |....:.||....|     |..|:
Zfish    56 ELFRNLERFQPPEGSLRILEVGCGSG----ANFEHYPTGS-KITCTDPNPHFKKY-----LEKSM 110

  Fly   126 SKRTRFFRRDLWKFDIKDYNFVVIFGVEQMMQDLEHKLIAECPHNTKIIACRFPLPSLEHV-KII 189
            .|....      ::|    ||:|..|  :.:|.:|..       :...:.|...|.|::.. |::
Zfish   111 EKNEHL------EYD----NFIVASG--ENLQAVEDS-------SVDAVVCTLVLCSVKDTNKVL 156

  Fly   190 ED 191
            ::
Zfish   157 QE 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3337NP_001303427.1 Methyltransf_18 78..167 CDD:289607 21/90 (23%)
mettl7a.2XP_021327508.1 Methyltransf_11 74..171 CDD:311935 25/114 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.