Sequence 1: | NP_001303427.1 | Gene: | CG3337 / 42519 | FlyBaseID: | FBgn0038871 | Length: | 204 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001124239.1 | Gene: | prmt9 / 553290 | ZFINID: | ZDB-GENE-080728-4 | Length: | 859 | Species: | Danio rerio |
Alignment Length: | 198 | Identity: | 48/198 - (24%) |
---|---|---|---|
Similarity: | 72/198 - (36%) | Gaps: | 74/198 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 PNP--LAKTPKSGMSTGGKILIAATGGVGIGLSIVCASFVAPAFR---RICLPYVPATTEQIQNV 68
Fly 69 LSFLPKNSAGKLLDIGSGDGRIVVAAAQHCGALKADGVELNPWLVYYSRLAALRHSVSKRTRFFR 133
Fly 134 RDLWKFDIKDYNFVVIFGVEQMMQDLEHKLIAECPHNTKIIACRFPLPSLEHVKIIEDGV---NT 195
Fly 196 VWF 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3337 | NP_001303427.1 | Methyltransf_18 | 78..167 | CDD:289607 | 25/88 (28%) |
prmt9 | NP_001124239.1 | TPR_11 | 72..135 | CDD:290150 | |
TPR repeat | 72..98 | CDD:276809 | |||
MAS20 | <96..133 | CDD:295844 | |||
TPR repeat | 103..133 | CDD:276809 | |||
AdoMet_MTases | 151..>267 | CDD:302624 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0500 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |