DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3337 and prmt9

DIOPT Version :9

Sequence 1:NP_001303427.1 Gene:CG3337 / 42519 FlyBaseID:FBgn0038871 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001124239.1 Gene:prmt9 / 553290 ZFINID:ZDB-GENE-080728-4 Length:859 Species:Danio rerio


Alignment Length:198 Identity:48/198 - (24%)
Similarity:72/198 - (36%) Gaps:74/198 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PNP--LAKTPKSGMSTGGKILIAATGGVGIGLSIVCASFVAPAFR---RICLPYVPATTEQIQNV 68
            |||  |..:|    |..|:::.|  |....|:::.|     |..|   |:|:             
Zfish   285 PNPGELLSSP----SQTGRVIPA--GATVFGVAVQC-----PEIRRHHRLCV------------- 325

  Fly    69 LSFLPKNSAGKLLDIGSGDGRIVVAAAQHCGALKADGVELNPWLVYYSRLAALRHSVSKRTRFFR 133
                  :|.|. ||: |..|:|....:  |.|...|..|  |:..  .||:.||....:.|:.|.
Zfish   326 ------SSVGG-LDL-SAVGQIYSPVS--CLADTEDSTE--PYTT--ERLSRLRGGYIQLTQPFT 376

  Fly   134 RDLWKFDIKDYNFVVIFGVEQMMQDLEHKLIAECPHNTKIIACRFPLPSLEHVKIIEDGV---NT 195
                ..|| |:|.|         |:||.....|.   .::..|           :.:||:   ..
Zfish   377 ----ALDI-DFNNV---------QELEGLCSREV---VQLCLC-----------VTQDGILDALA 413

  Fly   196 VWF 198
            |||
Zfish   414 VWF 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3337NP_001303427.1 Methyltransf_18 78..167 CDD:289607 25/88 (28%)
prmt9NP_001124239.1 TPR_11 72..135 CDD:290150
TPR repeat 72..98 CDD:276809
MAS20 <96..133 CDD:295844
TPR repeat 103..133 CDD:276809
AdoMet_MTases 151..>267 CDD:302624
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.