DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3337 and PRMT6

DIOPT Version :9

Sequence 1:NP_001303427.1 Gene:CG3337 / 42519 FlyBaseID:FBgn0038871 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_060607.2 Gene:PRMT6 / 55170 HGNCID:18241 Length:375 Species:Homo sapiens


Alignment Length:114 Identity:29/114 - (25%)
Similarity:49/114 - (42%) Gaps:21/114 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GKILIAATGGVGIGLSIVCASFVAPAFRRICLPYVPATTEQIQNVLSFLPKNSAGKLLDIGSGDG 88
            ||.::....|.|| |||.||...|   ||:......|..:|.:.|:.|   |.....:.:..|..
Human    83 GKTVLDVGAGTGI-LSIFCAQAGA---RRVYAVEASAIWQQAREVVRF---NGLEDRVHVLPGPV 140

  Fly    89 RIVVAAAQHCGALKADGVELNPW----LVYYSRLAALRHSVSKRTRFFR 133
            ..|....|      .|.: ::.|    |::.|.|:::.|:   ||::.:
Human   141 ETVELPEQ------VDAI-VSEWMGYGLLHESMLSSVLHA---RTKWLK 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3337NP_001303427.1 Methyltransf_18 78..167 CDD:289607 11/60 (18%)
PRMT6NP_060607.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
AdoMet_MTases 67..>200 CDD:418430 29/114 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.