DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3337 and Art1

DIOPT Version :9

Sequence 1:NP_001303427.1 Gene:CG3337 / 42519 FlyBaseID:FBgn0038871 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster


Alignment Length:121 Identity:24/121 - (19%)
Similarity:49/121 - (40%) Gaps:32/121 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GMSTGGKILIAATGGVGIGLSIVCASFVAPAFRRICLPYVPATTEQIQNVLSFLPKNSAGKLLDI 83
            |..||...:.||..|....:::.|::.:..| |::.:      ...:|:|::.:    .||:.:|
  Fly    99 GCGTGILSMFAAKAGAAQVIAVDCSNIIEFA-RQVVI------DNNLQDVITVV----KGKIEEI 152

  Fly    84 GSGDGRIVVAAAQHCGALKADGVE--LNPWLVYYSRLAALRHSVSKRTRFFRRDLW 137
            ...:|              .:||:  ::.|:.|     .|.:.....|..:.||.|
  Fly   153 ELPNG--------------IEGVDIIISEWMGY-----CLFYESMLDTVLYARDKW 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3337NP_001303427.1 Methyltransf_18 78..167 CDD:289607 13/62 (21%)
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 24/121 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.