DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3337 and H20J04.9

DIOPT Version :9

Sequence 1:NP_001303427.1 Gene:CG3337 / 42519 FlyBaseID:FBgn0038871 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001022224.1 Gene:H20J04.9 / 3565191 WormBaseID:WBGene00044310 Length:268 Species:Caenorhabditis elegans


Alignment Length:112 Identity:23/112 - (20%)
Similarity:38/112 - (33%) Gaps:40/112 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RHSVSKRTRFFRRDLWKFDIKDYNFV-----------------------VIFGVEQ---MMQDLE 160
            ::..||..|...:.:.|.||...:|:                       ::||||:   |.:...
 Worm    39 KYGASKSRRLNEKVVEKMDIGKDDFLFEIGFGRGDAMKMCFDRVKDGRGMVFGVERSGYMNERAI 103

  Fly   161 HKLIAECPHNTKI-----IACR-FPLPSLEHVKIIEDGVNTVWFYDL 201
            .:.:.|.....||     :..| .|.|:        |..|.|:..||
 Worm   104 KRFVLEIAETDKIRIDSAVDLRNLPYPT--------DLFNHVFHVDL 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3337NP_001303427.1 Methyltransf_18 78..167 CDD:289607 12/70 (17%)
H20J04.9NP_001022224.1 Methyltransf_25 66..166 CDD:379312 16/85 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.