DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3337 and Art8

DIOPT Version :9

Sequence 1:NP_001303427.1 Gene:CG3337 / 42519 FlyBaseID:FBgn0038871 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster


Alignment Length:136 Identity:32/136 - (23%)
Similarity:51/136 - (37%) Gaps:13/136 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KILIAATGGVGIGLSIVCASFVAPAFRRICLPY-VPATTEQIQNVLSFLPKNSAGKLLDIGSGDG 88
            ||::....|.|| ||..||...|.      |.| |.|:....:..|..:..|....::.:.....
  Fly    42 KIVMDVGAGTGI-LSAFCAKAGAR------LVYAVEASNVATKVALDLIEDNGLTNVVKVIQSRV 99

  Fly    89 RIVVAAAQHCGALKADGVELNPWLVYYSRLAALRHSV-SKRTRFFRRDLWKFDIKDYNFVVIFGV 152
            ...|..|:   |.|.| :.::.|:.:|.....:..|| ..|.:|.:.....|..:...||....|
  Fly   100 EEFVLPAE---AEKVD-IIVSEWMGFYLLHEGMLDSVLLARDKFLKEGGLLFPSECTIFVAPCSV 160

  Fly   153 EQMMQD 158
            ..:..|
  Fly   161 PSLFDD 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3337NP_001303427.1 Methyltransf_18 78..167 CDD:289607 16/82 (20%)
Art8NP_609478.1 SmtA 1..244 CDD:223574 32/136 (24%)
Methyltransf_18 40..147 CDD:289607 27/115 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.