DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3337 and Antkmt

DIOPT Version :9

Sequence 1:NP_001303427.1 Gene:CG3337 / 42519 FlyBaseID:FBgn0038871 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_663385.2 Gene:Antkmt / 214917 MGIID:2384888 Length:229 Species:Mus musculus


Alignment Length:182 Identity:77/182 - (42%)
Similarity:113/182 - (62%) Gaps:6/182 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LIAATGGVGIGLSIVCASFVAPAFRRICL----PYVPATTEQIQNVLSFLPKNSAGKLLDIGSGD 87
            ::.|..|.|:.:..:.|..:.|.|||:.|    |||.|:..|::||||.| :...||::|:||||
Mouse    23 IVQAAAGSGLAVYTIWALLLQPGFRRVPLRLQVPYVGASARQVENVLSLL-RGRPGKMVDLGSGD 86

  Fly    88 GRIVVAAAQHCGALKADGVELNPWLVYYSRLAALRHSVSKRTRFFRRDLWKFDIKDYNFVVIFGV 152
            ||||:||.| ||...|.|.|||||||..:||.|.|...|....:.|:||||..::|.:.|.:|..
Mouse    87 GRIVLAAHQ-CGLRPAMGYELNPWLVGLARLHAWRAGCSASVCYHRKDLWKVSLRDCHNVSVFLA 150

  Fly   153 EQMMQDLEHKLIAECPHNTKIIACRFPLPSLEHVKIIEDGVNTVWFYDLNKS 204
            ..::|.||.||.||.|...::::.|||||:.:.|.::.:|.:.||.||::.|
Mouse   151 PSVLQLLEDKLQAELPVGARVVSGRFPLPTWQPVAVVGEGTDRVWAYDVHGS 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3337NP_001303427.1 Methyltransf_18 78..167 CDD:289607 44/88 (50%)
AntkmtNP_663385.2 N-terminal sequence (NTS). /evidence=ECO:0000250|UniProtKB:Q9BQD7 1..22
Methyltransferase (MTase). /evidence=ECO:0000250|UniProtKB:Q9BQD7 43..77 15/34 (44%)
Pre-methyltransferase (preMT). /evidence=ECO:0000250|UniProtKB:Q9BQD7 43..77 15/34 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837720
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1605787at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101641
Panther 1 1.100 - - O PTHR13610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.710

Return to query results.
Submit another query.