DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3337 and C35D10.12

DIOPT Version :9

Sequence 1:NP_001303427.1 Gene:CG3337 / 42519 FlyBaseID:FBgn0038871 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_498018.1 Gene:C35D10.12 / 183240 WormBaseID:WBGene00016448 Length:365 Species:Caenorhabditis elegans


Alignment Length:195 Identity:37/195 - (18%)
Similarity:62/195 - (31%) Gaps:72/195 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PATTEQIQNVLSFLPKNSAGK-LLDIGSGDGRIV-----VAAAQHCGAL----KADGVE------ 107
            |::......|..|:.:.|||. :||:|.|:.:..     |.....|..:    |.|.::      
 Worm    30 PSSPRIWPRVRQFVDQQSAGSIILDVGCGEAKYTSQKSHVIGFDTCSEVLSSSKKDDIDLCLADA 94

  Fly   108 -------------LNPWLVYYSRLAALRHSV----SKRTRFFRRDL---WKFDIKDYNFVVIFGV 152
                         ||..::::....|.|..|    |:..|...:.|   |.|:..:..|.     
 Worm    95 INIPIRDDSVDAILNVSVIHHLATTARRRQVLQECSRCLRIGGQMLIYAWAFEQPNGKFA----- 154

  Fly   153 EQMMQDLEHKLIAECPHNT-------------------KIIACRFPLPSLEHVKIIEDGVNTVWF 198
               .||:   |:....|.|                   ::||...|      |.|.:..:...||
 Worm   155 ---SQDI---LVPWNMHETAIGGRLPKVKFHLNTTKEQRVIAASIP------VNISDGSIPQKWF 207

  Fly   199  198
             Worm   208  207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3337NP_001303427.1 Methyltransf_18 78..167 CDD:289607 23/124 (19%)
C35D10.12NP_498018.1 Methyltransf_11 53..141 CDD:369777 15/87 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.